Mollisia scopiformis: LY89DRAFT_681554 Help Entry LY89DRAFT_681554  CDS       T04865                                  Name (RefSeq) RNA polymerase Rpb6   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism psco  Mollisia scopiformis Pathway psco03020   RNA polymerase psco03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:psco00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     LY89DRAFT_681554   09124 Replication and repair    03420 Nucleotide excision repair     LY89DRAFT_681554  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:psco03021]     LY89DRAFT_681554    03400 DNA repair and recombination proteins [BR:psco03400]     LY89DRAFT_681554 Transcription machinery [BR:psco03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      LY89DRAFT_681554   RNA polymerase III system    RNA polymerase III      LY89DRAFT_681554   RNA polymerase I system    RNA polymerase I      LY89DRAFT_681554 DNA repair and recombination proteins [BR:psco03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       LY89DRAFT_681554 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  28824046 NCBI-ProteinID:  XP_018075271 JGI:  681554 UniProt:  A0A194XLA8 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MTKYEKARILGTRALQISMNAPVLVDLEGETDPLQIAIKELREKKIPLVVRRFMPDGWYE DWTCEELLQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaagtacgagaaggcaagaatcttgggaactagggcactgcagattagcatgaat gcgccagttcttgtggatttggaaggagagacagatccactccagattgcgatcaaggag ttgagagaaaagaagatacccttggtggtgagaagatttatgccggatggctggtacgag gactggacttgtgaagagcttctccagtaa

DBGET integrated database retrieval system