Pseudonocardia sp. AL041005-10: WY02_00145 Help Entry WY02_00145        CDS       T04051                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism psea  Pseudonocardia sp. AL041005-10 Pathway psea00261   Monobactam biosynthesis psea01100   Metabolic pathways psea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psea00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     WY02_00145  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psea01008]     WY02_00145 Polyketide biosynthesis proteins [BR:psea01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     WY02_00145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALE77156 UniProt:  A0A0M4QHC0 LinkDB All DBs Position 30050..30265 Genome browser AA seq 71 aa AA seqDB search MSNNPFDDENGQFFVLVNDEEQHSLWPAFAQVPAGWSVVHGEASRSDCLAYVETHWTDLR PKSLREAMASD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaacccgtttgacgacgagaacggtcagttcttcgtgctggtcaacgacgag gagcagcattctctctggccagcattcgcgcaggtcccggcggggtggtcggtcgttcac ggggaggcgtcccggtccgactgcctggcctacgtcgagacgcactggaccgacctgcga cctaagagcctccgcgaggcaatggcttcggactga

DBGET integrated database retrieval system