Pseudodesulfovibrio sediminis: PSDVSF_22720 Help Entry PSDVSF_22720      CDS       T08380                                  Name (GenBank) (Fe-S)-binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism psef  Pseudodesulfovibrio sediminis Pathway psef00020   Citrate cycle (TCA cycle) psef01100   Metabolic pathways psef01110   Biosynthesis of secondary metabolites psef01120   Microbial metabolism in diverse environments psef01200   Carbon metabolism psef01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:psef00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PSDVSF_22720 Enzymes [BR:psef01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PSDVSF_22720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_9 Fer4_8 Fer4_16 Fer4_4 Fer4_3 Fer4_15 Fer4_17 Fer4_22 Fer4_13 Fer4_18 ICAM_N Motif Other DBs NCBI-ProteinID:  BCS89030 LinkDB All DBs Position 2374361..2374594 Genome browser AA seq 77 aa AA seqDB search MSRIEVQEDRCKGCLLCTTVCPVDIIVQSDRFNVSGYKVAEVPEEDADKCTGCASCAQIC PDVAIKVYRTPKTKGGK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctcgaattgaggtccaggaagaccggtgcaaagggtgcttgctctgtaccacagtc tgccctgttgacatcatcgtccagtctgaccgtttcaacgtcagcggctataaggtcgca gaggtgcccgaggaagacgcggacaaatgtaccggttgtgcatcatgtgcacagatctgc cctgatgtggcgatcaaagtctaccgcaccccgaaaacaaaagggggcaaatag

DBGET integrated database retrieval system