Pseudonocardia sp. HH130629-09: XF36_26710 Help Entry XF36_26710        CDS       T04082                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism pseh  Pseudonocardia sp. HH130629-09 Pathway pseh00261   Monobactam biosynthesis pseh01100   Metabolic pathways pseh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pseh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     XF36_26710  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pseh01008]     XF36_26710 Polyketide biosynthesis proteins [BR:pseh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     XF36_26710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALE86285 UniProt:  A0A0M3UCK0 LinkDB All DBs Position 5750816..5751031 Genome browser AA seq 71 aa AA seqDB search MNPFEDENQTYLVLINDEGQYSLWPSFVEVPAGWTVVKGEDSRAACLDYINENWTDMRPR SLAEAMDGARL NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaatccgttcgaggacgagaaccagacctatctggtactgatcaacgacgagggccag tactcactgtggccttcattcgtcgaagtgccggcggggtggacggtcgtcaagggtgag gactcgcgcgcagcctgcctcgactacatcaacgagaactggaccgacatgcggccgcgg tccctcgctgaggcaatggacggcgcccgtctgtga

DBGET integrated database retrieval system