Pseudomonas sediminis: HNQ25_10295 Help Entry HNQ25_10295       CDS       T07154                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism psej  Pseudomonas sediminis Pathway psej00261   Monobactam biosynthesis psej01100   Metabolic pathways psej01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psej00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HNQ25_10295  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psej01008]     HNQ25_10295 Polyketide biosynthesis proteins [BR:psej01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HNQ25_10295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNH03086 UniProt:  A0A7G7RJY4 LinkDB All DBs Position 2211570..2211785 Genome browser AA seq 71 aa AA seqDB search MSLDSPETRFLVVVNAEEQYSIWPEYKEIPQGWLEAGKQGSKEECLAYIETVWTDMRPLS LRQAMQGQGRV NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagtctggacagtcctgaaacacgcttcctggttgtggtcaacgctgaagagcaatac tccatctggcctgagtacaaggaaataccgcaaggctggctcgaagccggcaagcagggc agcaaggaagaatgcctggcctacatcgaaacggtgtggaccgacatgcgcccgcttagc ttgcgtcaagccatgcaggggcaagggcgcgtttga

DBGET integrated database retrieval system