Pseudoalteromonas sp. NC201: PNC201_03610 Help Entry PNC201_03610      CDS       T05464                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism psen  Pseudoalteromonas sp. NC201 Pathway psen00261   Monobactam biosynthesis psen01100   Metabolic pathways psen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psen00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PNC201_03610  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psen01008]     PNC201_03610 Polyketide biosynthesis proteins [BR:psen01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PNC201_03610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AUJ69057 UniProt:  A0A2K9JU98 LinkDB All DBs Position 827111..827347 Genome browser AA seq 78 aa AA seqDB search MSVSCFDREDETFIVLINQEEQYSIWPEWKAVPVGWQAVAGVQGDKAHVQSYINEHWTDM RPASLRQWMAEQAQQGDA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagtgagctgttttgaccgcgaagatgaaaccttcatcgtgcttattaatcaagaa gaacaatattcaatttggcccgagtggaaagcggtaccagtgggttggcaagctgtagct ggtgttcagggcgataaggcccacgtgcaaagctacattaacgagcactggactgatatg cgtcctgcttctttgcgtcagtggatggctgagcaagcgcaacaaggtgacgcgtga

DBGET integrated database retrieval system