Pseudomonas aeruginosa B136-33: G655_12990 Help Entry G655_12990        CDS       T02627                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism psg  Pseudomonas aeruginosa B136-33 Pathway psg00261   Monobactam biosynthesis psg01100   Metabolic pathways psg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     G655_12990  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psg01008]     G655_12990 Polyketide biosynthesis proteins [BR:psg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     G655_12990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGI81517 LinkDB All DBs Position 2823981..2824199 Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system