Pseudomonas sichuanensis: LOY51_16500 Help Entry LOY51_16500       CDS       T08582                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism psih  Pseudomonas sichuanensis Pathway psih00261   Monobactam biosynthesis psih01100   Metabolic pathways psih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psih00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LOY51_16500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psih01008]     LOY51_16500 Polyketide biosynthesis proteins [BR:psih01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LOY51_16500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UVL87386 LinkDB All DBs Position complement(3675474..3675695) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIVFQVVINHEEQYSIWPDYKAIPNGWRAAGKSGLKQDCLAWIDEVWTDMRP LSLRQQMAAAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgacatcgtgttccaggtagtgatcaaccacgaagag caatattccatctggcccgactacaaggccatccccaatggctggcgcgcggccggcaaa agcggcctgaagcaggactgcctggcctggatcgacgaagtctggaccgacatgcgcccg ctgagcctgcgccagcagatggccgcagccgccgcgcagtga

DBGET integrated database retrieval system