Pseudomonas solani: PSm6_48570 Help Entry PSm6_48570        CDS       T09213                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism psoa  Pseudomonas solani Pathway psoa00261   Monobactam biosynthesis psoa01100   Metabolic pathways psoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psoa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PSm6_48570  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psoa01008]     PSm6_48570 Polyketide biosynthesis proteins [BR:psoa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PSm6_48570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCD88450 LinkDB All DBs Position 5272082..5272300 Genome browser AA seq 72 aa AA seqDB search MVFDRDDVIFQVVINQEEQYSIWPDYKAIPAGWRAAGKSGLKKDCLEFIEQNWTDMRPLS LRQKMDQDKVVA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggttttcgatcgtgacgatgtgatcttccaggtggtcatcaaccaggaggagcagtac tcgatctggccggactacaaggccatccccgccggctggcgcgccgccggcaaaagcggc ctgaagaaggactgcctcgagttcatcgagcagaactggaccgacatgcgcccgctgagc ctgcggcagaagatggaccaggacaaagtggtggcctga

DBGET integrated database retrieval system