Porphyromonas somerae: CE91St14_20150 Help Entry CE91St14_20150    CDS       T08199                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism psoe  Porphyromonas somerae Pathway psoe00020   Citrate cycle (TCA cycle) psoe01100   Metabolic pathways psoe01110   Biosynthesis of secondary metabolites psoe01120   Microbial metabolism in diverse environments psoe01200   Carbon metabolism psoe01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:psoe00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CE91St14_20150 Enzymes [BR:psoe01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CE91St14_20150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_7 Fer4_6 Fer4_10 Fer4_9 Fer4_2 Fer4_16 Fer4_15 Fer4_4 Fer4_17 Fer4_13 Fer4_3 Fer4_8 Motif Other DBs NCBI-ProteinID:  BDE82987 LinkDB All DBs Position complement(2462961..2463191) Genome browser AA seq 76 aa AA seqDB search MTKTVKGTVVIDQVRCKGCNLCAVACPTGTLAMHPVEINDKGYHFSYMANPENCIGCANC GLVCPDACITVYRAKK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgactaagacagtaaaagggaccgtggtgatcgaccaagtgcgctgcaaggggtgtaac ctctgtgccgtggcttgcccgacaggtaccctagcaatgcaccctgtcgagatcaacgac aaagggtatcacttctcttatatggctaatcccgagaattgtatcgggtgtgccaattgc gggctagtatgccccgacgcatgtatcacagtctatagagctaagaagtaa

DBGET integrated database retrieval system