Phytophthora sojae: PHYSODRAFT_284939 Help Entry PHYSODRAFT_284939 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism psoj  Phytophthora sojae Pathway psoj03020   RNA polymerase psoj03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:psoj00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PHYSODRAFT_284939   09124 Replication and repair    03420 Nucleotide excision repair     PHYSODRAFT_284939  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:psoj03021]     PHYSODRAFT_284939    03400 DNA repair and recombination proteins [BR:psoj03400]     PHYSODRAFT_284939 Transcription machinery [BR:psoj03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PHYSODRAFT_284939   RNA polymerase III system    RNA polymerase III      PHYSODRAFT_284939   RNA polymerase I system    RNA polymerase I      PHYSODRAFT_284939 DNA repair and recombination proteins [BR:psoj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PHYSODRAFT_284939 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD Nudix_N_2 GATA TF_Zn_Ribbon zf-Mss51 zinc_ribbon_13 FYDLN_acid Motif Other DBs NCBI-GeneID:  20639901 NCBI-ProteinID:  XP_009519823 JGI:  Physo3_284939 UniProt:  G4YXP6 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MDGGATPAAGAAGTSASASMIKDPEIKYICGDCGIVNYLSARDPIRCRACGYRIMYKART KRLIQFEAR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacggcggagcgacccctgcagccggcgcggccggcaccagcgccagcgcgtccatg atcaaggacccggagatcaagtacatctgcggcgactgcggcatcgtcaactacctgtcg gcgcgcgaccccatccgctgccgcgcgtgcggctaccgcatcatgtacaaggcgcgcacc aagcgcctcatccagttcgaggcccggtaa

DBGET integrated database retrieval system