Pseudomonas syringae pv. tomato DC3000: PSPTO_2137 Help Entry PSPTO_2137        CDS       T00118                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism pst  Pseudomonas syringae pv. tomato DC3000 Pathway pst00261   Monobactam biosynthesis pst01100   Metabolic pathways pst01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pst00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PSPTO_2137  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pst01008]     PSPTO_2137 Polyketide biosynthesis proteins [BR:pst01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PSPTO_2137 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AAO55654 UniProt:  Q884F6 LinkDB All DBs Position 2322528..2322755 Genome browser AA seq 75 aa AA seqDB search MTSVFDREDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMEAQTAVSH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgatcgggaagacatcgtctttcaagttgtagtcaaccacgaagaa cagtactcgatctggcccgactacaaagccatccccaacggctggcgcacggtcggcaaa agcggcttcaagaaagaatgcctggcttacatcgaggaagtctggaccgacatgcgcccc ctgagcctgcgccagaaaatggaagcgcagacggcggtaagtcactga

DBGET integrated database retrieval system