Pseudoxanthomonas suwonensis 11-1: Psesu_0196 Help Entry Psesu_0196        CDS       T01403                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism psu  Pseudoxanthomonas suwonensis 11-1 Pathway psu00790   Folate biosynthesis psu01100   Metabolic pathways psu01240   Biosynthesis of cofactors Module psu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:psu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Psesu_0196 Enzymes [BR:psu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Psesu_0196  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Psesu_0196  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Psesu_0196 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADV26058 UniProt:  E6WP85 LinkDB All DBs Position 217344..217709 Genome browser AA seq 121 aa AA seqDB search MDKVFIEGLEIEALIGIYDWERRIRQTLRFDLEMAFDNRVPAASDDIAHTLDYKAVSKRL VEYVQQSGFGLVETLAERCAALVIEEFGVQWVRLKLSKPGAVRGARAVGVIIERNAPAKE S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggacaaagtcttcatcgagggcctcgagatcgaggcgctgatcggcatctacgactgg gaacggcggatccgccagaccctgcgtttcgacctggagatggcgttcgacaaccgcgtg cccgcggccagcgacgacatcgcccacaccctggactacaaggcggtgagcaagcgcctg gtcgagtacgtgcagcagtccggattcggcctggtcgagaccctggccgagcgctgcgcg gcgctggtcatcgaggaattcggcgtgcaatgggtgcgcctaaagctcagcaagccaggt gcagtgcgcggtgcacgggcggtgggcgtgatcatcgagcgcaatgcgccggcgaaggag tcgtaa

DBGET integrated database retrieval system