Phytohabitans suffuscus: Psuf_065500 Help Entry Psuf_065500       CDS       T06545                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism psuu  Phytohabitans suffuscus Pathway psuu00261   Monobactam biosynthesis psuu01100   Metabolic pathways psuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psuu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Psuf_065500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psuu01008]     Psuf_065500 Polyketide biosynthesis proteins [BR:psuu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Psuf_065500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCB89237 UniProt:  A0A6F8YSX1 LinkDB All DBs Position 7029885..7030076 Genome browser AA seq 63 aa AA seqDB search MNPFDDPDGRFFVLVNDEEQHSLWPSHLALPDGWRVVHGEDDRQACLDYVERHWTDLRPL SAR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgaacccgttcgacgaccccgacggccggttcttcgtcctcgtgaacgacgaggagcag cactcgctgtggcccagccacctcgccctaccggacggatggcgggtggtgcacggtgag gacgaccgccaggcctgcctcgactacgtggagcggcactggaccgacctgcgcccgctc agcgcgcgttga

DBGET integrated database retrieval system