Phytohabitans suffuscus: Psuf_070530 Help Entry Psuf_070530       CDS       T06545                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism psuu  Phytohabitans suffuscus Pathway psuu00261   Monobactam biosynthesis psuu01100   Metabolic pathways psuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psuu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Psuf_070530  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psuu01008]     Psuf_070530 Polyketide biosynthesis proteins [BR:psuu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Psuf_070530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCB89740 UniProt:  A0A6F8YUB6 LinkDB All DBs Position 7566696..7566905 Genome browser AA seq 69 aa AA seqDB search MSNPFEDADARYRVLMNDEAQYSLWPAAIACPDGWSVVHGDDSRSACIEYIEKQWTDMRP ASLVRAEHG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgtccaacccgttcgaagacgccgacgcccgctatcgggttctgatgaatgacgaagcc cagtactcgctgtggcccgccgcaatcgcctgcccggacggctggagcgtcgtacacggc gacgattcccgctccgcctgcatcgagtacatcgagaaacagtggacagacatgcgtccg gcaagccttgtccgcgcagagcatggctga

DBGET integrated database retrieval system