Phytohabitans suffuscus: Psuf_092880 Help Entry Psuf_092880       CDS       T06545                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism psuu  Phytohabitans suffuscus Pathway psuu00261   Monobactam biosynthesis psuu01100   Metabolic pathways psuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psuu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Psuf_092880 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psuu01008]     Psuf_092880 (mbtH) Polyketide biosynthesis proteins [BR:psuu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Psuf_092880 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCB91975 UniProt:  A0A6F8Z0M0 LinkDB All DBs Position complement(10002624..10002833) Genome browser AA seq 69 aa AA seqDB search MSDDRGYQVVRNDEEQYSIWWTDRDLPAGWYAEGTEGTRDECLAKIGEIWTDMRPLSLRL RMEAAGSAA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgaccgcggctaccaggtggtgcgcaacgacgaggagcagtactcgatctgg tggaccgaccgggacctgccggccggctggtacgccgagggtaccgagggcacccgcgac gagtgcctcgccaagatcggtgagatctggaccgacatgcgcccgctgagcctgcgcctg cggatggaggcggccggctccgccgcgtga

DBGET integrated database retrieval system