Pseudomonas sp. VLB120: PVLB_15340 Help Entry PVLB_15340        CDS       T02897                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism psv  Pseudomonas sp. VLB120 Pathway psv00261   Monobactam biosynthesis psv01100   Metabolic pathways psv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PVLB_15340  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psv01008]     PVLB_15340 Polyketide biosynthesis proteins [BR:psv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PVLB_15340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGZ35852 UniProt:  A0AA86DVX5 LinkDB All DBs Position complement(3357782..3358003) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatattcagttccaggtagtggtcaaccacgaagag caatactccatttggcccgactacaaggccatccccaacggctggcgcgccgtgggcaag agcggcctgaagaaggactgcctggcctacatcgacgaggtctggaccgacatgcgccct ctgagcctacgtcagaagatggctgaagccgcggcgcagtga

DBGET integrated database retrieval system