Psychrobacillus sp. INOP01: KD050_11315 Help Entry KD050_11315       CDS       T09653                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism psyb  Psychrobacillus sp. INOP01 Pathway psyb00790   Folate biosynthesis psyb01100   Metabolic pathways psyb01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:psyb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     KD050_11315 (folB) Enzymes [BR:psyb01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      KD050_11315 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      KD050_11315 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      KD050_11315 (folB) BRITE hierarchy Motif Pfam:  FolB AF2331-like Motif Other DBs NCBI-ProteinID:  QUG39929 LinkDB All DBs Position 2232649..2233014 Genome browser AA seq 121 aa AA seqDB search MDYIHLNDLEFYGFHGALPEETKLGQIFRVTITLACDLKKAGETDNLDETVNYAEVFELC KGIVEGKPYLLIEAVAEKIASSILEAYSAKVSGCRIQLVKPNPPIVGHYASVAVDITRGT L NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggattatatacatttgaatgacttagaattttacggatttcacggagcattaccagag gaaacgaagctaggtcaaatatttcgagtgacaatcaccttagcgtgcgatttaaaaaaa gctggagaaaccgataatttagatgaaaccgtaaattatgcagaggtctttgagctatgc aaaggaattgtagaaggtaaaccctatttattaatagaagcagttgcagaaaaaattgct tcgtctattttggaggcatattcagctaaggttagtggctgccgtatacaattggtgaaa ccaaacccgccgattgtcggacactatgcttctgtagctgtcgatatcacaagaggcaca ttatga

DBGET integrated database retrieval system