Pseudomonas taiwanensis: ICN73_22825 Help Entry ICN73_22825       CDS       T09297                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ptai  Pseudomonas taiwanensis Pathway ptai00261   Monobactam biosynthesis ptai01100   Metabolic pathways ptai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptai00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ICN73_22825  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ptai01008]     ICN73_22825 Polyketide biosynthesis proteins [BR:ptai01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ICN73_22825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QOJ90675 UniProt:  A0A7L9GE79 LinkDB All DBs Position complement(5095553..5095774) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggcccgactacaaagccatccccaacggctggcgagccgtgggcaaa agcggcttgaagaaggactgcctggcctacatcgatgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagctgccgcccagtga

DBGET integrated database retrieval system