Parageobacillus toebii NBRC 107807: DER53_05065 Help Entry DER53_05065       CDS       T06505                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ptb  Parageobacillus toebii NBRC 107807 Pathway ptb00790   Folate biosynthesis ptb01100   Metabolic pathways ptb01240   Biosynthesis of cofactors Module ptb_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ptb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     DER53_05065 (folB) Enzymes [BR:ptb01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      DER53_05065 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      DER53_05065 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      DER53_05065 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QIQ32302 UniProt:  A0A6G9J296 LinkDB All DBs Position 992142..992522 Genome browser AA seq 126 aa AA seqDB search MEKEWRAIDKIYLHRMEFYGYHGVLPEENVLGQRFIVDVILETDLQKAGKSDRLDDTINY AEVYDICRNVVEKRRFSLIEAVAETIAEQILSSFPTVARCTIKVTKPNPPIQGHYESVAV EIVRGR NT seq 381 nt NT seq  +upstreamnt  +downstreamnt ttggaaaaggagtggagagcgatcgataaaatttatcttcatcggatggagttttatgga tatcacggcgtccttcccgaagaaaatgtgcttggacagcgctttattgtagatgtcatt ctcgaaacggatttacaaaaggctggaaaaagcgatcgattagatgataccattaattat gcggaagtgtatgatatttgccgaaatgttgtcgagaaaaggagattttcgttaatcgaa gcagtagcagagacgattgcggagcaaattttatcttcttttccaaccgttgctcgttgt acgattaaagtgacaaaaccaaatccacccattcaaggtcattatgaatctgtagcagta gaaattgtaaggggtcgttag

DBGET integrated database retrieval system