Pyrenophora teres: PTT_11419 Help Entry PTT_11419         CDS       T01613                                  Name (GenBank) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism pte  Pyrenophora teres Pathway pte03020   RNA polymerase pte03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pte00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PTT_11419   09124 Replication and repair    03420 Nucleotide excision repair     PTT_11419  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pte03021]     PTT_11419    03400 DNA repair and recombination proteins [BR:pte03400]     PTT_11419 Transcription machinery [BR:pte03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PTT_11419   RNA polymerase III system    RNA polymerase III      PTT_11419   RNA polymerase I system    RNA polymerase I      PTT_11419 DNA repair and recombination proteins [BR:pte03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PTT_11419 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 KH_1 Motif Other DBs NCBI-ProteinID:  EFQ91661 UniProt:  E3RRI1 LinkDB All DBs Position Unknown AA seq 163 aa AA seqDB search MSDYGGDDYGGDAGDMGDDHAIEFDEEAEPDLMDDEDDQPGGGEDPDNADPNDDNVVVSG DANAAAAAKEASKNTVTSEKDKRVPNEKRTTTPYMTKYEKARVLGTRALQISGNAPVLID VEGMTDPLQIAAKELQEKKIPLVVRRYLPDGFYEDWTCEELLT NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgtctgactacggtggcgacgactacggcggtgatgctggggacatgggggacgaccat gccatcgagttcgatgaggaagcggaacccgatctgatggacgacgaagacgaccagccc ggcggcggcgaagacccagacaatgccgaccccaacgacgacaatgttgtagtgtcaggc gatgccaacgcggcagctgcagccaaagaagcctccaagaatacagttacgagcgaaaag gacaagagagtccccaacgagaagcgcacaaccacgccatacatgaccaagtatgaaaag gcgcgtgtgctgggcacaagagcgcttcaaatcagtggtaacgctccggtgttgatcgac gtagagggtatgacggatcccctccagattgctgccaaagaattgcaggaaaagaagatt cccctcgttgtacggcgctaccttcctgatggcttttacgaggactggacgtgcgaagag cttctgacttga

DBGET integrated database retrieval system