Pelotomaculum thermopropionicum: PTH_0059 Help Entry PTH_0059          CDS       T00519                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pth  Pelotomaculum thermopropionicum Pathway pth00020   Citrate cycle (TCA cycle) pth01100   Metabolic pathways pth01110   Biosynthesis of secondary metabolites pth01120   Microbial metabolism in diverse environments pth01200   Carbon metabolism pth01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pth00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PTH_0059 Enzymes [BR:pth01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PTH_0059 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_9 Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_16 Fer4_10 Fer4_4 Fer4_6 Fer4_17 Fer4_8 Fer4_22 Fer4_15 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  BAF58240 UniProt:  A5D687 LinkDB All DBs Position 60071..60328 Genome browser AA seq 85 aa AA seqDB search MTPEFVPKTQKLEKGTFILFPALCKGCGLCIEKCPKKSIGWSEVLGVYGTPTVEANNSCI ACGICQAVCPDCAIRIEKNGTAGRP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacaccggaattcgtaccaaaaacgcagaagctcgagaagggcacgtttatccttttt cccgccctttgcaagggatgcgggctgtgcatagaaaaatgccccaaaaagtcaatcggc tggtcggaagtgctgggagtatacggaacccccacggtagaagctaacaacagttgcatt gcctgcggcatctgccaggccgtatgcccggactgcgccatcaggattgaaaaaaatgga acggcagggaggccttaa

DBGET integrated database retrieval system