Pelotomaculum thermopropionicum: PTH_0848 Help Entry PTH_0848          CDS       T00519                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pth  Pelotomaculum thermopropionicum Pathway pth00020   Citrate cycle (TCA cycle) pth01100   Metabolic pathways pth01110   Biosynthesis of secondary metabolites pth01120   Microbial metabolism in diverse environments pth01200   Carbon metabolism pth01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pth00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PTH_0848 Enzymes [BR:pth01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PTH_0848 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_6 Fer4_10 Fer4_7 Fer4_15 Fer4_9 Fer4_13 Fer4_16 Fer4_4 Fer4_17 Fer4_22 ORF158L-like Fer4_3 Motif Other DBs NCBI-ProteinID:  BAF59029 UniProt:  A5D3Y6 LinkDB All DBs Position complement(856472..856705) Genome browser AA seq 77 aa AA seqDB search MAAMAETVSSSTKKKAIVINKNWCKGCGICASLCSRVLAMDSTGKAVAVNPYLCTGCRVC ESHCPDFAISIGVEGIE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggcggcaatggctgagacagtatcttcttcaactaaaaagaaagcaatagttattaat aaaaactggtgcaaggggtgcggaatatgcgcatccctgtgctccagggtgctggctatg gacagcacgggcaaggcggtagccgtcaatccatacctttgcaccggctgccgcgtgtgc gaaagccactgtccggattttgccatttcgataggagtggaaggcattgaatga

DBGET integrated database retrieval system