Paenibacillus thiaminolyticus: NDS46_04710 Help Entry NDS46_04710       CDS       T08812                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pthi  Paenibacillus thiaminolyticus Pathway pthi00261   Monobactam biosynthesis pthi01100   Metabolic pathways pthi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pthi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NDS46_04710  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pthi01008]     NDS46_04710 Polyketide biosynthesis proteins [BR:pthi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NDS46_04710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WCF09210 LinkDB All DBs Position 1037770..1037997 Genome browser AA seq 75 aa AA seqDB search MSNPFEQADGAYLVLINEEGQYSLWPAFAAVPDGWSTVLGPETRQGCLDYITLHWTDLRP RSLRDSSDPVHGATQ NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgagtaatccttttgagcaagcggacggcgcttatctggtgctaattaatgaggagggg caatattcgttgtggcctgccttcgccgcggtgccggatggatggagtacggtcctgggg ccggagacgcgtcagggttgtctggactatatcaccctgcattggaccgacttgcggccc cgcagcctgcgcgattcttcggatcctgtccatggagcaacgcaatga

DBGET integrated database retrieval system