Phaeodactylum tricornutum: PHATRDRAFT_14927 Help Entry PHATRDRAFT_14927  CDS       T01075                                  Name (RefSeq) hypothetical protein   KO K19054   frataxin [EC:1.16.3.1] Organism pti  Phaeodactylum tricornutum Pathway pti00860   Porphyrin metabolism Brite KEGG Orthology (KO) [BR:pti00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     PHATRDRAFT_14927  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pti03029]     PHATRDRAFT_14927 Enzymes [BR:pti01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      PHATRDRAFT_14927 Mitochondrial biogenesis [BR:pti03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Proteins involved in Fe-S cluster biogenesis     PHATRDRAFT_14927 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Frataxin_Cyay Motif Other DBs NCBI-GeneID:  7203618 NCBI-ProteinID:  XP_002182972 JGI:  14927 UniProt:  B7G752 LinkDB All DBs Position 17:complement(475739..475999) Genome browser AA seq 87 aa AA seqDB search TEGEYHGIADDALDHIQDAIDEALDSTTLEYEVTLASGVLTLSLPPHGTWVVNKQTPNQQ LWWSSPLSGPKRYEYDEADKLWFSTKD NT seq 261 nt NT seq  +upstreamnt  +downstreamnt acagaaggggagtaccatggaatagcggatgacgctctggaccacattcaggatgcgatc gacgaagctctggattccacgacgcttgagtacgaggtcacgttggcgtcgggcgttctc accctttcgttgccaccccacggaacgtgggttgtcaacaaacaaacgccaaaccagcag ttgtggtggtcaagtccattgagcggacccaaacgatacgagtatgatgaagccgacaaa ctctggttctcgaccaaggat

DBGET integrated database retrieval system