Pseudomonas tremae: I9H09_15925 Help Entry I9H09_15925       CDS       T08237                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ptre  Pseudomonas tremae Pathway ptre00261   Monobactam biosynthesis ptre01100   Metabolic pathways ptre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptre00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I9H09_15925  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ptre01008]     I9H09_15925 Polyketide biosynthesis proteins [BR:ptre01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I9H09_15925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UQB35065 LinkDB All DBs Position complement(3531538..3531756) Genome browser AA seq 72 aa AA seqDB search MTSVFDREDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMEAQTA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgatcgggaagacatcgtctttcaagtggtggtcaaccacgaagaa cagtattcgatctggcccgactacaaagccattcctaacggctggcgcacagtgggcaaa agcggcttcaagaaagaatgcctggcctacatcgaagaagtctggaccgacatgcgcccc ctgagcctgcgccagaaaatggaagcgcagacggcgtag

DBGET integrated database retrieval system