Pseudomonas tritici: HU722_0020560 Help Entry HU722_0020560     CDS       T07594                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ptrt  Pseudomonas tritici Pathway ptrt00261   Monobactam biosynthesis ptrt01100   Metabolic pathways ptrt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptrt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU722_0020560  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ptrt01008]     HU722_0020560 Polyketide biosynthesis proteins [BR:ptrt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU722_0020560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXH82365 UniProt:  A0A8I0CU30 LinkDB All DBs Position complement(4530735..4530956) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGMKKECLAYIEEVWTDMRP LSLRQKMDGATLA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtatttgaccgcgacgacatcctgtttcaggtagtggtcaaccatgaagaa cagtactccatctggcccgactacaaagccgtgccggaaggctggcggaccgtgggtaag agcggcatgaagaaagagtgcctggcctacatcgaagaagtctggaccgacatgcgcccg ctgagcctgcgtcagaaaatggacggtgccacgctcgcctga

DBGET integrated database retrieval system