Paraburkholderia terricola: CUJ90_10860 Help Entry CUJ90_10860       CDS       T05812                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pts  Paraburkholderia terricola Pathway pts00261   Monobactam biosynthesis pts01100   Metabolic pathways pts01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pts00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CUJ90_10860  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pts01008]     CUJ90_10860 Polyketide biosynthesis proteins [BR:pts01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CUJ90_10860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXE92776 UniProt:  A0A1M6R5N7 LinkDB All DBs Position mHS1_A:complement(2452789..2453019) Genome browser AA seq 76 aa AA seqDB search MSWGDENSNFVVVVNHEEQYSIWPDYKAIPAGWREAGKSGKKDECLQWIDEVWTDMRPLS LREALADSAAQGVTNA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagctggggtgacgaaaacagcaatttcgttgtcgttgtaaatcatgaagaacagtat tcgatctggccggactacaaggccattcctgccggctggcgcgaggcggggaagtcgggc aagaaggacgaatgcctgcaatggatcgacgaggtatggacggatatgcgtccgctgagc ttgcgcgaggcgctggccgacagcgcggcgcaaggcgtcaccaatgcgtga

DBGET integrated database retrieval system