Pseudomonas tohonis: TUM18999_27310 Help Entry TUM18999_27310    CDS       T07887                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ptw  Pseudomonas tohonis Pathway ptw00261   Monobactam biosynthesis ptw01100   Metabolic pathways ptw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     TUM18999_27310  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ptw01008]     TUM18999_27310 Polyketide biosynthesis proteins [BR:ptw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     TUM18999_27310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCG24540 UniProt:  A0A6J4E4K2 LinkDB All DBs Position 2983064..2983282 Genome browser AA seq 72 aa AA seqDB search MVFDRDDVVFQVVINHEEQYSIWPDYKAIPAGWRAAGKSGLKQECLAYIEEHWTDMRPLS LRKQMEQAEGVA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggtgttcgatcgtgatgacgtggtgttccaggtggtcatcaaccacgaggagcagtac tcgatctggccggactacaaggccattcccgccggctggcgcgccgccggcaagagcggg ctgaagcaggagtgcctggcgtacatcgaggagcactggaccgacatgcgccccctgagc ctgcgcaagcagatggaacaggccgaaggggtggcctga

DBGET integrated database retrieval system