Pseudomonas tensinigenes: HU718_021090 Help Entry HU718_021090      CDS       T07620                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ptz  Pseudomonas tensinigenes Pathway ptz00261   Monobactam biosynthesis ptz01100   Metabolic pathways ptz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU718_021090  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ptz01008]     HU718_021090 Polyketide biosynthesis proteins [BR:ptz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU718_021090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI04520 LinkDB All DBs Position complement(4781444..4781668) Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGLKKECLAYIEETWTDMRP LSLRQKMDGQAAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag caatactcgatctggccggattacaaagccgtgccagaaggctggcgcactgtgggtaag agcggcctgaaaaaggaatgcctggcctacattgaagaaacctggactgacatgcgtccg ctgagcctgcgtcagaagatggacgggcaggccgccgcgcaataa

DBGET integrated database retrieval system