Pusillimonas sp. DMV24BSW_D: G9Q38_00140 Help Entry G9Q38_00140       CDS       T06486                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pud  Pusillimonas sp. DMV24BSW_D Pathway pud00790   Folate biosynthesis pud01100   Metabolic pathways pud01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:pud00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     G9Q38_00140 (folB) Enzymes [BR:pud01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      G9Q38_00140 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      G9Q38_00140 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      G9Q38_00140 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QIM47697 UniProt:  A0A6G8I3I0 LinkDB All DBs Position 35603..35968 Genome browser AA seq 121 aa AA seqDB search MLTRRIYFSQLALDARIGILEHELRATQPLHIDVEVDIDISQPVNDHNIQTVLDYRLLRS AIVEECTQAHVNLIETLVEQVADRLFREFAEVRHLKLRISKPNAFSDCAAVGVEIQRSRN D NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcttacccgccgtatttatttttcacagttggcgcttgacgcccgtattggtatcctt gaacacgaactgcgtgccacgcaacctttgcatattgatgttgaagtggacattgatatt tcgcaaccggtaaatgatcacaatattcaaaccgtgctcgattaccgcctgctgcgcagc gccattgtggaagaatgtacgcaggcccacgtaaacctcatcgaaacactggtcgaacaa gtggccgaccgtctgtttcgcgagtttgcagaagtgcgccacctgaaactacgtatcagc aaacccaatgccttttccgactgcgccgcagtcggcgttgaaattcaacgcagccgcaac gattaa

DBGET integrated database retrieval system