Pseudomonas viridiflava: CFBP1590__1995 Help Entry CFBP1590__1995    CDS       T06554                                  Name (GenBank) Conserved hypothetical protein   KO K05375   MbtH protein Organism pvd  Pseudomonas viridiflava Pathway pvd00261   Monobactam biosynthesis pvd01100   Metabolic pathways pvd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CFBP1590__1995  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pvd01008]     CFBP1590__1995 Polyketide biosynthesis proteins [BR:pvd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CFBP1590__1995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  SMS09581 UniProt:  A0A0Q0F723 LinkDB All DBs Position I:2070317..2070544 Genome browser AA seq 75 aa AA seqDB search MTSVFDREDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMDAQTAASH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgaccgggaagacatcgtctttcaagtggtggtcaaccacgaagaa cagtattcgatctggcccgactacaaagccatccccaacggctggcgcaccgtgggcaag agcggcttcaagaaagaatgcctggcctacattgaagaagtctggaccgacatgcgtcct ctgagcctgcgccagaagatggacgcgcagacggcggcgagccactga

DBGET integrated database retrieval system