Pseudomonas viridiflava: CFBP1590__3653 Help Entry CFBP1590__3653    CDS       T06554                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism pvd  Pseudomonas viridiflava Pathway pvd00261   Monobactam biosynthesis pvd01100   Metabolic pathways pvd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CFBP1590__3653  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pvd01008]     CFBP1590__3653 Polyketide biosynthesis proteins [BR:pvd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CFBP1590__3653 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Dioxygenase_C Motif Other DBs NCBI-ProteinID:  SMS11239 UniProt:  A0A0D0N8V6 LinkDB All DBs Position I:complement(4024589..4024777) Genome browser AA seq 62 aa AA seqDB search MNEPDSQFEVVTNDEGQYSIWPAGKPMAVGWSKAGVCGERQTCLDYIAEHWTDMRPRSLR EG NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgaacgaacctgactcgcagttcgaagtggtcaccaatgatgaaggccagtattccatc tggccagcgggcaagccgatggctgttggctggagcaaggcgggcgtgtgtggcgagcgg caaacctgtctggactacatcgccgagcactggaccgacatgcgtccgcgctcgctgcgc gaagggtga

DBGET integrated database retrieval system