Penaeus vannamei (Pacific white shrimp): 113806491 Help Entry 113806491         CDS       T06111                                  Name (RefSeq) GTP cyclohydrolase 1-like   KO K01495   GTP cyclohydrolase IA [EC:3.5.4.16] Organism pvm  Penaeus vannamei (Pacific white shrimp) Pathway pvm00790   Folate biosynthesis pvm01100   Metabolic pathways pvm01240   Biosynthesis of cofactors Module pvm_M00842   Tetrahydrobiopterin biosynthesis, GTP => BH4 Brite KEGG Orthology (KO) [BR:pvm00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     113806491 Enzymes [BR:pvm01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.4  In cyclic amidines     3.5.4.16  GTP cyclohydrolase I      113806491 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GTP_cyclohydroI QueF B56 Motif Other DBs NCBI-GeneID:  113806491 NCBI-ProteinID:  XP_027213434 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MNDAVFEEDTEDMVIVKDIEMFSTCEHHLVPFWGKVSVGYLPNKKVMGLSKIARIVEVFS RRLQVQERLTKQIAEAVVEAVQPAGVAVVVEGT NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaacgacgccgtgttcgaggaggacacggaggacatggtcatcgtgaaggacatcgag atgttctccacgtgcgagcaccacctggttcccttctggggcaaggtgtcggtcggttac ctgcccaacaagaaggtcatgggactctccaagatagccagaattgtcgaagtcttcagc cgtagattgcaagtccaagagaggctgaccaagcagatcgcggaagccgtcgtggaggcc gttcagcccgcgggagtcgctgttgtggtggaaggaacgtga

DBGET integrated database retrieval system