Paenibacillus vortex: PVOR_24559 Help Entry PVOR_24559        CDS       T05385                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism pvo  Paenibacillus vortex Pathway pvo00261   Monobactam biosynthesis pvo01100   Metabolic pathways pvo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PVOR_24559  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pvo01008]     PVOR_24559 Polyketide biosynthesis proteins [BR:pvo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PVOR_24559 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  EFU39507 UniProt:  A0A2R9SQ54 LinkDB All DBs Position complement(108897..109124) AA seq 75 aa AA seqDB search MTNPFEQADGKYVVLMNHEGQYSLWPAFAAIPDGWTQALGLSTREECMTYINENWVDLRP RSLYANAGSAPENRP NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccttttgaacaagccgatggcaaatatgtcgtattgatgaatcatgaggga caatattcgctttggccggctttcgcggctattccagatggctggactcaagcgctgggg cttagcacacgagaagagtgcatgacctacatcaacgaaaactgggtcgatttacggccg cggagtttatatgcgaatgccggatcggcaccggaaaacaggccatga

DBGET integrated database retrieval system