Pseudomonas veronii: PverR02_22280 Help Entry PverR02_22280     CDS       T04853                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pvr  Pseudomonas veronii Pathway pvr00261   Monobactam biosynthesis pvr01100   Metabolic pathways pvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PverR02_22280  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pvr01008]     PverR02_22280 Polyketide biosynthesis proteins [BR:pvr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PverR02_22280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQY67652 UniProt:  A0A0R3BEP0 LinkDB All DBs Position complement(4915080..4915301) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGMKKECLAYIEEVWTDMRP LSLRQKMDGTALA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtattcgaccgcgacgacatcctgtttcaggtagtggtcaaccatgaagaa cagtattcgatctggcccgactacaaggccgtgccggaaggctggcgcaccgtgggcaag agcggcatgaagaaggagtgcctggcctacatcgaagaggtctggaccgacatgcgtccg ttgagcctgcgccagaaaatggacggcaccgcgctggcttga

DBGET integrated database retrieval system