Pseudomonas vanderleydeniana: HU752_023605 Help Entry HU752_023605      CDS       T07587                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pvw  Pseudomonas vanderleydeniana Pathway pvw00261   Monobactam biosynthesis pvw01100   Metabolic pathways pvw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU752_023605  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pvw01008]     HU752_023605 Polyketide biosynthesis proteins [BR:pvw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU752_023605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI26884 UniProt:  A0A9E6PHZ2 LinkDB All DBs Position complement(5284256..5284474) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIVFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGFKKECLAYIEEVWTDMRP LSLRQKMDAQVA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgatcgcgatgacatcgtctttcaggtggtggtcaatcacgaggag cagtattcgatctggccggactacaaggcaatccccaatggctggcgagccgtaggcaag agcggcttcaagaaggagtgcctggcctacatcgaggaggtctggaccgacatgcgcccc ctgagcctgcgccagaagatggacgcccaggtggcctga

DBGET integrated database retrieval system