Pectobacterium parmentieri WPP163: Pecwa_3734 Help Entry Pecwa_3734        CDS       T01106                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism pwa  Pectobacterium parmentieri WPP163 Pathway pwa00261   Monobactam biosynthesis pwa01100   Metabolic pathways pwa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pwa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pecwa_3734  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pwa01008]     Pecwa_3734 Polyketide biosynthesis proteins [BR:pwa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pecwa_3734 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACX89469 LinkDB All DBs Position complement(4117494..4117700) Genome browser AA seq 68 aa AA seqDB search MSQEQQNPFDNDSLTFYVLMNTQRQYSLWPAFADVPAGWHQVIGPDTRTACMTYIETHWV DMRPASLQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagccaggaacagcaaaatccttttgataatgacagtctgacattttacgtactcatg aatacgcaacgtcaatacagcctctggcctgcgtttgccgacgttcctgcgggatggcat caggttattggcccagacacgcgaacggcctgcatgacttatatcgaaactcactgggtg gacatgcggcctgccagcctgcaatag

DBGET integrated database retrieval system