Pseudomonas xanthosomatis: KSS93_18335 Help Entry KSS93_18335       CDS       T07606                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pxa  Pseudomonas xanthosomatis Pathway pxa00261   Monobactam biosynthesis pxa01100   Metabolic pathways pxa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pxa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KSS93_18335  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pxa01008]     KSS93_18335 Polyketide biosynthesis proteins [BR:pxa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KSS93_18335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXH44836 LinkDB All DBs Position complement(4177644..4177859) Genome browser AA seq 71 aa AA seqDB search MAFDREDATFKVLVNAEEQYSLWPDYKAVPAGWREAGKSGAKQECLDYIESVWTDMRPLS LRQHMDGQAGR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggctttcgaccgcgaagacgcaacgttcaaggtactggtcaacgccgaggagcagtac tcgctgtggcctgactacaaggccgtgccggccggctggcgcgaggccggcaagagcggc gccaagcaggagtgcctggactacatcgaatcggtctggaccgacatgcgccccctgagc ctgcgccagcacatggacgggcaggccggccggtga

DBGET integrated database retrieval system