Pseudomonas xantholysinigenes: HU772_014795 Help Entry HU772_014795      CDS       T07643                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pxn  Pseudomonas xantholysinigenes Pathway pxn00261   Monobactam biosynthesis pxn01100   Metabolic pathways pxn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pxn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU772_014795  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pxn01008]     HU772_014795 Polyketide biosynthesis proteins [BR:pxn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU772_014795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI36617 UniProt:  A0A9E6PS76 LinkDB All DBs Position complement(3346753..3346968) Genome browser AA seq 71 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQQMAAAQ NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgtgacgacatccagttccaggtagtggtcaaccacgaagag cagtactcgatctggcccgactacaaggccatccccaacggctggcgcgcggtcggcaag agtggcctgaagaaggattgcctggcctatatcgacgaagtgtggaccgacatgcgccca ctgagcctgcgccagcagatggccgcggcgcagtaa

DBGET integrated database retrieval system