Papilio xuthus (Asian swallowtail): 106118930 Help Entry 106118930         CDS       T07456                                  Name (RefSeq) ferritin subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism pxu  Papilio xuthus (Asian swallowtail) Pathway pxu00860   Porphyrin metabolism Brite KEGG Orthology (KO) [BR:pxu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     106118930  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pxu04147]     106118930 Enzymes [BR:pxu01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      106118930 Exosome [BR:pxu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    106118930   Exosomal proteins of bladder cancer cells    106118930 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  106118930 NCBI-ProteinID:  XP_013169151 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MKLIDYLLMRGELETDVTSLIQIRAPERKSWESGVDALEHALKMETEVTKSIRSVIIACE SDPKFNDYHLVDYLTGEFLEEQYKGQRDLAGKASTLKKMLDRHSSLGEFLFDKKLLGMDI NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgaagttaattgattatttgcttatgagaggtgaactggaaactgatgtcacttcgttg atacagattagggcccctgaacgtaaatcttgggagagcggcgtggacgcgcttgagcac gctctgaaaatggaaaccgaagtgacgaagagcattcggtctgtcatcatcgcttgcgag tccgatcctaagttcaacgactaccatctcgtggactacctgactggtgaattcttggaa gaacaatacaagggccagagagacctcgcgggcaaagcgtctacactcaagaagatgctc gaccgccactcctcactcggagagttcctttttgataagaaactccttggaatggatatt taa

DBGET integrated database retrieval system