Pseudomonas yamanorum: AK972_1707 Help Entry AK972_1707        CDS       T05821                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism pym  Pseudomonas yamanorum Pathway pym00261   Monobactam biosynthesis pym01100   Metabolic pathways pym01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pym00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AK972_1707  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pym01008]     AK972_1707 Polyketide biosynthesis proteins [BR:pym01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AK972_1707 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AMW82507 LinkDB All DBs Position 1832033..1832257 Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGMKKECLAYIEEVWTDMRP LSLRQKMDSQALAG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtattcgaccgcgaagacatcctgtttcaggtagtggtcaaccatgaagaa caatattccatctggcccgactacaaggccgtgccggaaggctggcgcaccgtgggcaag agcgggatgaagaaagagtgcctggcctacatcgaagaagtgtggaccgacatgcgcccg ttgagcctgcgccagaagatggacagccaggcgttggcgggctga

DBGET integrated database retrieval system