Pseudomonas zeae: HU754_020900 Help Entry HU754_020900      CDS       T07528                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pze  Pseudomonas zeae Pathway pze00261   Monobactam biosynthesis pze01100   Metabolic pathways pze01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pze00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU754_020900  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pze01008]     HU754_020900 Polyketide biosynthesis proteins [BR:pze01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU754_020900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI10257 UniProt:  A0A9E6NML5 LinkDB All DBs Position complement(4758736..4758960) Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGLKKECLAYIEEVWTDMRP LSLRQKMEAQTAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag caatactcgatctggccggactacaaagccgtgccgcaaggttggcgcaccgtgggcaag agcggcctgaaaaaggaatgcctggcctatatcgaagaagtctggaccgacatgcgtccg ctgagcctgcgtcagaagatggaagcccagaccgccgcgcaataa

DBGET integrated database retrieval system