Qipengyuania soli: IRL76_03245 Help Entry IRL76_03245       CDS       T09808                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism qso  Qipengyuania soli Pathway qso00790   Folate biosynthesis qso01100   Metabolic pathways qso01240   Biosynthesis of cofactors Module qso_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:qso00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     IRL76_03245 Enzymes [BR:qso01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      IRL76_03245  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      IRL76_03245  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      IRL76_03245 BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QPC99598 UniProt:  A0A7S8F5Y4 LinkDB All DBs Position 651593..651964 Genome browser AA seq 123 aa AA seqDB search MTDSLILEVADFEHDVLTGIYSEETGRPQPLRFTIQARMKPLAKYEAETSLDASKNYMDL KFAASEALPEGVHFKLIEAVADHVCETLFLQDSRVEAVTVKIVKLAIAEAHEKIGITLHR ERR NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgaccgattcgctgatcctcgaggtggccgatttcgagcacgacgtgctcaccggcatc tattccgaagagaccgggcgcccgcagccgctgcgcttcaccatccaggcgcggatgaag ccgctggcgaagtacgaggccgagacctcgctcgatgcgagcaagaactacatggatctg aagttcgcggcctccgaagctttgcccgaaggcgtccatttcaagctgatcgaggcagtt gccgaccacgtctgcgaaaccctgttcctgcaggacagccgcgtcgaggcggtcaccgtt aagatcgtcaagctcgccatcgccgaggcgcacgagaagatcggcatcaccctccaccgc gagcgccggtga

DBGET integrated database retrieval system