Quercus suber (cork oak): 112014057 Help Entry 112014057         CDS       T05868                                  Name (RefSeq) dihydroneopterin aldolase 2-like   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism qsu  Quercus suber (cork oak) Pathway qsu00790   Folate biosynthesis qsu01100   Metabolic pathways qsu01240   Biosynthesis of cofactors Module qsu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:qsu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     112014057 Enzymes [BR:qsu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      112014057  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      112014057  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      112014057 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FolB MC8 Motif Other DBs NCBI-GeneID:  112014057 NCBI-ProteinID:  XP_023902209 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MENVAMVKGDKLILRGLKFHGYHGVKPEERKLGQKFLVDVDAWLDLQPAGKSDCLSDTVS YTDIYRIVKEVVEGPAHNLLESVAQLIASTTLTKHPQISAVRVVVGKPHVAVLGSVDYLG VEILRYRSVDASN NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggagaatgttgcaatggtgaagggagacaaactcatattaaggggtttgaagttccat ggatatcatggggtgaagccagaagaaaggaagctgggtcagaagttcttggtggatgtt gatgcctggttggaccttcagccagctggtaaatctgattgcttgtcagatactgttagt tatactgatatttaccgaatagttaaagaagttgtggaagggcctgcacacaatcttcta gagtcagtggctcaactcattgcatctaccactttgacaaagcacccccagatatctgct gttcgtgtggtagtcggaaagcctcatgttgcagttcttggttctgttgactacttgggc gttgagattctcagatacagaagtgtagatgcatcaaattga

DBGET integrated database retrieval system