Rahnella aceris Y9602: Rahaq_0617 Help Entry Rahaq_0617        CDS       T01422                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rah  Rahnella aceris Y9602 Pathway rah00790   Folate biosynthesis rah01100   Metabolic pathways rah01240   Biosynthesis of cofactors Module rah_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rah00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Rahaq_0617 Enzymes [BR:rah01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Rahaq_0617  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Rahaq_0617  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Rahaq_0617 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADW72244 UniProt:  A0A0H3F8F4 LinkDB All DBs Position 652131..652487 Genome browser AA seq 118 aa AA seqDB search MDIVFIEQLNVITTIGAYEWEQTIKQKLVFDIEMAWDNQKSAATDDVNDCLSYADVSDAV IGHVSSQNFALVERVAEEVATLLLSRFNSPWVRIKLSKPGAVAQAANVGVIIERGKRF NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatatcgtatttattgagcaactaaatgtaatcactaccattggcgcttacgaatgg gaacagaccattaaacagaaactggtattcgatatcgaaatggcctgggataaccaaaag tccgccgccactgacgatgtgaatgactgtttaagctatgctgatgtcagtgatgcggtg atcgggcatgtttcttcacaaaattttgcgctggttgaacgcgtagcggaagaggtggcg acattgctgctgagccggtttaattctccgtgggttcggattaagctcagcaaaccgggc gctgttgctcaggcagcgaatgtcggcgtgattatcgagcgtggaaagcgtttttaa

DBGET integrated database retrieval system