Rothia amarae: IDM48_01485 Help Entry IDM48_01485       CDS       T06930                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rama  Rothia amarae Pathway rama00790   Folate biosynthesis rama01100   Metabolic pathways rama01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:rama00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     IDM48_01485 (folB) Enzymes [BR:rama01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      IDM48_01485 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      IDM48_01485 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      IDM48_01485 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB MgtE_N Motif Other DBs NCBI-ProteinID:  QNV40909 UniProt:  A0A7H2BML3 LinkDB All DBs Position 308978..309343 Genome browser AA seq 121 aa AA seqDB search MDRITLTGVGVVGYHGVLDSEKQSGQPFFVDITMFTDFQRASESDDVENTVNYAEVAELI RDVITGDSLDLIETLAENIAQAVLARFPLEALELTVHKPKAPIEVTFSDVSVTVFRERKC L NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggatcgtatcactctgactggagtgggggtagtgggttatcacggtgttttagattct gagaagcagtccggccagcctttctttgtagacattacgatgtttactgattttcaacgc gcctctgaaagtgatgatgttgaaaacaccgtgaattatgccgaggttgcagagttaatt cgggatgtcattaccggagattccttggatttgattgagactcttgcggaaaatattgcg caggctgttttggctcgttttcccttggaagctttggaacttaccgtccataagccaaag gcacccatcgaggttaccttctctgatgtttctgtcaccgtattcagggagagaaaatgt ctgtaa

DBGET integrated database retrieval system