Rhizobium anhuiense bv. trifolii: NE851_32980 Help Entry NE851_32980       CDS       T08535                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism raw  Rhizobium anhuiense bv. trifolii Pathway raw00261   Monobactam biosynthesis raw01100   Metabolic pathways raw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:raw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NE851_32980  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:raw01008]     NE851_32980 Polyketide biosynthesis proteins [BR:raw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NE851_32980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UTS94014 LinkDB All DBs Position pRA_T24_2:267768..267986 Genome browser AA seq 72 aa AA seqDB search MNNLEPHDDLWIAVIDTERRYSVWPQDKRIPIGWEPAGFAGSRQQCLAHIREVWADPRPL SLRLAISADARL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaataatcttgagccccacgacgatctctggatcgccgttatcgacaccgagcgtcgc tactcggtctggccgcaggacaagcggattcccatcggctgggagcccgcgggttttgcc ggttcgcgccagcaatgcctggcgcatatccgtgaggtctgggcggatccgcgtccgctc tccttgcgcttggcgatatcagcagatgcgcgtctctga

DBGET integrated database retrieval system