Rouxiella badensis: H2866_06285 Help Entry H2866_06285       CDS       T06835                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rbad  Rouxiella badensis Pathway rbad00261   Monobactam biosynthesis rbad01100   Metabolic pathways rbad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbad00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H2866_06285  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rbad01008]     H2866_06285 Polyketide biosynthesis proteins [BR:rbad01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H2866_06285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QOI56730 LinkDB All DBs Position complement(1377689..1377898) Genome browser AA seq 69 aa AA seqDB search MEKLNPFDDENQRSLILENEEKQFCLWPDFSEIPAGWQPIFGPALRADCISWLESHWQDM RPASQRAAS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaaaagcttaaccccttcgatgacgaaaatcagcgcagtctgatcctggaaaacgag gagaagcagttctgcctgtggccggatttcagcgaaattcctgcgggctggcagccgatt tttgggccggcattgcgcgctgattgtatcagctggctggaaagccattggcaggatatg cgtcccgcctcgcagcgcgccgcttcataa

DBGET integrated database retrieval system