Rouxiella chamberiensis: O1V66_19170 Help Entry O1V66_19170       CDS       T08677                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism rcb  Rouxiella chamberiensis Pathway rcb00261   Monobactam biosynthesis rcb01100   Metabolic pathways rcb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rcb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     O1V66_19170  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:rcb01008]     O1V66_19170 Polyketide biosynthesis proteins [BR:rcb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     O1V66_19170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WAT00894 LinkDB All DBs Position 4098430..4098624 Genome browser AA seq 64 aa AA seqDB search MEKLNPFDDEQQPTLVVQNGQQQYSLWPDFSAIPAGWQPVFGPTARAECITWLESHWPTL QPAS NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtggaaaagcttaatccttttgatgacgaacaacagcccactctggtggtgcaaaacggc cagcagcaatacagcctgtggcccgatttcagcgcgatcccggcaggctggcagccggta ttcgggccgacagcgcgtgccgagtgcataacctggctcgagagccattggcccactctg cagccggcttcgtag

DBGET integrated database retrieval system